APTSTAT3-9R, a specific STAT3-binding peptide, inhibitsSTAT3activation and downstream signaling by specifically blockingSTAT3phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity^[1].

APTSTAT3-9R (7.5, 15, and 30 μmol/L; 6 hours) significantly reduces STAT3–DNA-binding activity in a dose-dependent manner in human lung carcinoma cells (A549)^[1].
APTSTAT3-9R (30 μM; for 2 weeks) suppresses cell viability and proliferation of cancer cells and significantly suppresses colony formation. APTSTAT3-9R has IC50s of 10 to 20 μM in A549, B16F1 and HepG2 cells^[1].
APTSTAT3-9R (7.5, 15, and 30 μmol/L; 6 hours) effectively inhibits phosphorylation of STAT3 but does not affect the level of AKT phosphorylation, indicating specificity of the aptide^[1].

APTSTAT3-9R (8 mg/kg in 50 μL; intratumorally injected every other day for a total of four injections) suppresses tumor growth in 6-week-old female BALB/c nude mice with A549 cells^[1].

4947.51

C_223H330N₈₀O₅₁

His-Gly-Phe-Gln-Trp-Pro-Gly-Ser-Trp-Thr-Trp-Glu-Asn-Gly-Lys-Trp-Thr-Trp-Lys-Gly-Ala-Tyr-Gln-Phe-Leu-Lys-Gly-Gly-Gly-Gly-Ser-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg

HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.