CRF, bovine is a potent agonist ofCRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with aK_iof 3.52 nM.

Ki: 3.52 nM (CRF receptor)^[1]

CRF, bovine is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with aK_iof 3.52 nM^[1]. CRF shows pEC₅₀s of 11.16, 8.53 and 8.70 for human CRF₁, human CRF₂and rat CRF_2α^[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC^[3].

4697.34

C₂₀₆H₃₄₀N₆₀O₆₃S

92307-52-3

Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.