Adrenomedullin(1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation ofCGRP1 receptor.

CGRP1 receptor^[1]

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor^[1].

Adrenomedullin (1-50), rat causes a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature, and this effect is inhibited by CGRP1 receptor antagonist. Adrenomedullin (1-50), rat activates CGRP1 receptor in the double-perfused mesenteric bed of the rat^[1]. Adrenomedullin (1-50) ameliorates pulmonary vascular structural remodeling of hypoxic rats with incresed plasma NO and H(2)S concentrations. Adrenomedullin (1-50) also regulates the development of hypoxic pulmonary hypertension and hypoxic pulmonary vascular structural remodeling, through promoting NO and H(2)S production in hypoxic rats^[2].

5729.50

Solid

C₂₄₂H₃₈₁N₇₇O₇₅S₅

Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19)

YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19)

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light, under nitrogen

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)