Adrenomedullin(AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH₂terminal truncatedadrenomedullinanalogue, is anadrenomedullinreceptorantagonist.Adrenomedullin(AM) (22-52), human also antagonizes thecalcitoningenerelated peptide(CGRP)receptor in the hindlimb vascular bed of the cat^[1].

Adrenomedullin receptor, CGRP receptor^[1]

Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist^[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells^[1].

3690.06

C₁₆₁H₂₅₃N₄₆F₃O₅₀

Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.