Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance K_Ca(SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo^[1].

For scyllatoxin, the Arg₆and Arg₁₃are essential for binding to the Ca²⁺-activated K⁺channel protein and for the functional effect of the toxin^[1].
For scyllatoxin, His₃₁is important for the binding activity of the toxin and for the induction of contractions on taenia coli^[1].

Scyllatoxin (2 μM) increases basal Epi release, the nerve stimulation-induced Epi release and the exogenous acetylcholine (Ach)-induced catecholamine release by microdialysis technique to the left adrenal medulla of anesthetized adult male Wistar rats^[2].

3423.15

C₁₄₂H₂₃₇N₄₅O₃₉S₇

142948-19-4

AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.